Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ENC1 monoclonal antibody (M03), clone 3C10

  • Catalog # : H00008507-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ENC1.
  • Immunogen:
  • ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ENC1 monoclonal antibody (M03), clone 3C10. Western Blot analysis of ENC1 expression in IMR-32 ( Cat # L008V1 ).
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ENC1 is approximately 10ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8507
  • Gene Name:
  • ENC1
  • Gene Alias:
  • CCL28,ENC-1,FLJ39259,KLHL35,KLHL37,NRPB,PIG10,TP53I10
  • Gene Description:
  • ectodermal-neural cortex (with BTB-like domain)
  • Gene Summary:
  • DNA damage and/or hyperproliferative signals activate wildtype p53 tumor suppressor protein (TP53; MIM 191170), inducing cell cycle arrest or apoptosis. Mutations that inactivate p53 occur in 50% of all tumors. Polyak et al. (1997) [PubMed 9305847] used serial analysis of gene expression (SAGE) to evaluate cellular mRNA levels in a colorectal cancer cell line transfected with p53. Of 7,202 transcripts identified, only 14 were expressed at levels more than 10-fold higher in p53-expressing cells than in control cells. Polyak et al. (1997) [PubMed 9305847] termed these genes 'p53-induced genes,' or PIGs, several of which were predicted to encode redox-controlling proteins. They noted that reactive oxygen species (ROS) are potent inducers of apoptosis. Flow cytometric analysis showed that p53 expression induces ROS production, which increases as apoptosis progresses under some conditions. The authors stated that the PIG10 gene, also called ENC1, encodes an actin-binding protein.[supplied by OMIM
  • Other Designations:
  • kelch-like 35,kelch-like 37,nuclear restricted protein, BTB domain-like (brain),tumor protein p53 inducible protein 10
  • RSS
  • YouTube
  • Linkedin
  • Facebook