ENC1 monoclonal antibody (M02), clone 3B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ENC1.
Immunogen
ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ENC1 monoclonal antibody (M02), clone 3B1 Western Blot analysis of ENC1 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ENC1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — ENC1
Entrez GeneID
8507GeneBank Accession#
NM_003633Protein Accession#
NP_003624Gene Name
ENC1
Gene Alias
CCL28, ENC-1, FLJ39259, KLHL35, KLHL37, NRPB, PIG10, TP53I10
Gene Description
ectodermal-neural cortex (with BTB-like domain)
Omim ID
605173Gene Ontology
HyperlinkGene Summary
DNA damage and/or hyperproliferative signals activate wildtype p53 tumor suppressor protein (TP53; MIM 191170), inducing cell cycle arrest or apoptosis. Mutations that inactivate p53 occur in 50% of all tumors. Polyak et al. (1997) [PubMed 9305847] used serial analysis of gene expression (SAGE) to evaluate cellular mRNA levels in a colorectal cancer cell line transfected with p53. Of 7,202 transcripts identified, only 14 were expressed at levels more than 10-fold higher in p53-expressing cells than in control cells. Polyak et al. (1997) [PubMed 9305847] termed these genes 'p53-induced genes,' or PIGs, several of which were predicted to encode redox-controlling proteins. They noted that reactive oxygen species (ROS) are potent inducers of apoptosis. Flow cytometric analysis showed that p53 expression induces ROS production, which increases as apoptosis progresses under some conditions. The authors stated that the PIG10 gene, also called ENC1, encodes an actin-binding protein.[supplied by OMIM
Other Designations
kelch-like 35|kelch-like 37|nuclear restricted protein, BTB domain-like (brain)|tumor protein p53 inducible protein 10
-
Interactome
-
Publication Reference
-
Characterization of Differential Gene Expression in Adrenocortical Tumors Harboring {beta}-Catenin (CTNNB1) Mutations.
Durand J, Lampron A, Mazzuco TL, Chapman A, Bourdeau I.
The Journal of Clinical Endocrinology and Metabolism 2011 Jul; 96(7):E1206.
Application:WB-Ce, Human, H295R cells.
-
Characterization of Differential Gene Expression in Adrenocortical Tumors Harboring {beta}-Catenin (CTNNB1) Mutations.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com