PIK3R3 monoclonal antibody (M02), clone 2F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PIK3R3 monoclonal antibody (M02), clone 2F8. Western Blot analysis of PIK3R3 expression in human spleen.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIK3R3 is 0.1 ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between EGFR and PIK3R3. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-PIK3R3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIK3R3.
Immunogen
PIK3R3 (AAH21622, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PIK3R3 monoclonal antibody (M02), clone 2F8. Western Blot analysis of PIK3R3 expression in human spleen.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIK3R3 is 0.1 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between EGFR and PIK3R3. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-PIK3R3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — PIK3R3
Entrez GeneID
8503GeneBank Accession#
BC021622Protein Accession#
AAH21622Gene Name
PIK3R3
Gene Alias
DKFZp686P05226, FLJ41892, p55, p55-GAMMA
Gene Description
phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
Omim ID
606076Gene Ontology
HyperlinkGene Summary
O
Other Designations
100% homology to SWISS-PROT Q92569|OTTHUMP00000009783|OTTHUMP00000009786|phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 3 (p55, gamma)|phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma)|phosphoinositide-3-kinase, regulatory subun
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com