RANBP3 monoclonal antibody (M01), clone 2E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RANBP3 expression in transfected 293T cell line by RANBP3 monoclonal antibody (M01), clone 2E10.
Lane 1: RANBP3 transfected lysate(42.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RANBP3 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RANBP3 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RANBP3.
Immunogen
RANBP3 (AAH04349, 298 a.a. ~ 397 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWLLRHPHPSHPAVGPCLCGEQPALCPCPGLPNYRPGTPAQLGGLLVRV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RANBP3 expression in transfected 293T cell line by RANBP3 monoclonal antibody (M01), clone 2E10.
Lane 1: RANBP3 transfected lysate(42.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RANBP3 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RANBP3 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RANBP3
Entrez GeneID
8498GeneBank Accession#
BC004349Protein Accession#
AAH04349Gene Name
RANBP3
Gene Alias
DKFZp586I1520
Gene Description
RAN binding protein 3
Omim ID
603327Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
RAN-binding protein-3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com