Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RGS5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008490-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RGS5 partial ORF ( NM_003617, 94 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • WIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.42
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008490-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8490
  • Gene Name:
  • RGS5
  • Gene Alias:
  • MST092,MST106,MST129,MSTP032,MSTP092,MSTP106,MSTP129
  • Gene Description:
  • regulator of G-protein signaling 5
  • Gene Summary:
  • The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000032361,Regulator of G protein signaling-5,regulator of G-protein signalling 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook