RGS5 monoclonal antibody (M01), clone 4E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RGS5 expression in transfected 293T cell line by RGS5 monoclonal antibody (M01), clone 4E12.
Lane 1: RGS5 transfected lysate (Predicted MW: 20.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RGS5 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RGS5.
Immunogen
RGS5 (NM_003617, 94 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RGS5 expression in transfected 293T cell line by RGS5 monoclonal antibody (M01), clone 4E12.
Lane 1: RGS5 transfected lysate (Predicted MW: 20.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RGS5 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — RGS5
Entrez GeneID
8490GeneBank Accession#
NM_003617Protein Accession#
NM_003617Gene Name
RGS5
Gene Alias
MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129
Gene Description
regulator of G-protein signaling 5
Gene Ontology
HyperlinkGene Summary
The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM
Other Designations
OTTHUMP00000032361|Regulator of G protein signaling-5|regulator of G-protein signalling 5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com