RGS5 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RGS5 protein.
Immunogen
RGS5 (NP_003608.1, 1 a.a. ~ 181 a.a) full-length human protein.
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Host
Rabbit
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RGS5 MaxPab rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in human kidney.Western Blot (Tissue lysate)
RGS5 MaxPab rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in mouse kidney.Western Blot (Tissue lysate)
RGS5 MaxPab rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in rat brain.Western Blot (Tissue lysate)
RGS5 MaxPab rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of RGS5 expression in transfected 293T cell line (H00008490-T02) by RGS5 MaxPab polyclonal antibody.
Lane 1: RGS5 transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of RGS5 transfected lysate using anti-RGS5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with RGS5 purified MaxPab mouse polyclonal antibody (B01P) (H00008490-B01P). -
Gene Info — RGS5
Entrez GeneID
8490GeneBank Accession#
NM_003617Protein Accession#
NP_003608.1Gene Name
RGS5
Gene Alias
MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129
Gene Description
regulator of G-protein signaling 5
Gene Ontology
HyperlinkGene Summary
The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM
Other Designations
OTTHUMP00000032361|Regulator of G protein signaling-5|regulator of G-protein signalling 5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com