Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RGS5 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00008490-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RGS5 protein.
  • Immunogen:
  • RGS5 (NP_003608.1, 1 a.a. ~ 181 a.a) full-length human protein.
  • Sequence:
  • MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RGS5 expression in transfected 293T cell line (H00008490-T01) by RGS5 MaxPab polyclonal antibody.

    Lane 1: RGS5 transfected lysate(19.91 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8490
  • Gene Name:
  • RGS5
  • Gene Alias:
  • MST092,MST106,MST129,MSTP032,MSTP092,MSTP106,MSTP129
  • Gene Description:
  • regulator of G-protein signaling 5
  • Gene Summary:
  • The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000032361,Regulator of G protein signaling-5,regulator of G-protein signalling 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook