SEMA7A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SEMA7A partial ORF ( NP_003603, 536 a.a. - 633 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.52
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SEMA7A
Entrez GeneID
8482GeneBank Accession#
NM_003612Protein Accession#
NP_003603Gene Name
SEMA7A
Gene Alias
CD108, CDw108, H-SEMA-K1, H-Sema-L, JMH, MGC126692, MGC126696, SEMAK1, SEMAL
Gene Description
semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
Omim ID
607961Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene
Other Designations
John Milton Hagen blood group H-Sema K1|sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin) 7A (JMH blood group)|sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, 7A|semaphorin 7A|semaphorin K1|semaphorin L
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Plexin C1 deficiency permits synaptotagmin 7-mediated macrophage migration and enhances mammalian lung fibrosis.
Peng X, Moore M, Mathur A, Zhou Y, Sun H, Gan Y, Herazo-Maya JD, Kaminski N, Hu X, Pan H, Ryu C, Osafo-Addo A, Homer RJ, Feghali-Bostwick C, Fares W, Gulati M, Hu B, Lee CG, Elias JA, Herzog EL.
FASEB Journal 2016 Sep; 30(12):4056.
Application:Boyden chamber assays, Human, Monocytes.
-
Role of semaphorin 7a signaling in transforming growth factor β1-induced lung fibrosis and scleroderma-related interstitial lung disease.
Gan Y, Reilkoff R, Peng X, Russell T, Chen Q, Mathai SK, Homer R, Gulati M, Siner J, Elias J, Bucala R, Herzog E.
Arthritis Rheum 2011 Apr; 63:2484.
Application:Incubated, Recombinant protein.
-
Plexin C1 deficiency permits synaptotagmin 7-mediated macrophage migration and enhances mammalian lung fibrosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com