Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC42BPA (Human) Recombinant Protein (Q01)

  • Catalog # : H00008476-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDC42BPA partial ORF ( NP_003598, 551 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLRE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008476-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8476
  • Gene Name:
  • CDC42BPA
  • Gene Alias:
  • DKFZp686L1738,DKFZp686P1738,FLJ23347,KIAA0451,MRCK,MRCKA,PK428
  • Gene Description:
  • CDC42 binding protein kinase alpha (DMPK-like)
  • Gene Summary:
  • The protein encoded by this gene is a member of the Serine/Threonine protein kinase family. This kinase contains multiple functional domains. Its kinase domain is highly similar to that of the myotonic dystrophy protein kinase (DMPK). This kinase also contains a Rac interactive binding (CRIB) domain, and has been shown to bind CDC42. It may function as a CDC42 downstream effector mediating CDC42 induced peripheral actin formation, and promoting cytoskeletal reorganization. Multiple alternatively spliced transcript variants have been described, and the full-length nature of two of them has been reported. [provided by RefSeq
  • Other Designations:
  • CDC42 binidng protein kinase beta,CDC42-binding protein kinase alpha,CDC42-binding protein kinase alpha (DMPK-like),OTTHUMP00000035727,OTTHUMP00000035728,myotonic dystrophy kinase-related CDC42-binding protein kinase alpha,ser-thr protein kinase PK428,ser
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook