CDC42BPA (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDC42BPA partial ORF ( NP_003598, 551 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLRE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDC42BPA
Entrez GeneID
8476GeneBank Accession#
NM_003607Protein Accession#
NP_003598Gene Name
CDC42BPA
Gene Alias
DKFZp686L1738, DKFZp686P1738, FLJ23347, KIAA0451, MRCK, MRCKA, PK428
Gene Description
CDC42 binding protein kinase alpha (DMPK-like)
Omim ID
603412Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Serine/Threonine protein kinase family. This kinase contains multiple functional domains. Its kinase domain is highly similar to that of the myotonic dystrophy protein kinase (DMPK). This kinase also contains a Rac interactive binding (CRIB) domain, and has been shown to bind CDC42. It may function as a CDC42 downstream effector mediating CDC42 induced peripheral actin formation, and promoting cytoskeletal reorganization. Multiple alternatively spliced transcript variants have been described, and the full-length nature of two of them has been reported. [provided by RefSeq
Other Designations
CDC42 binidng protein kinase beta|CDC42-binding protein kinase alpha|CDC42-binding protein kinase alpha (DMPK-like)|OTTHUMP00000035727|OTTHUMP00000035728|myotonic dystrophy kinase-related CDC42-binding protein kinase alpha|ser-thr protein kinase PK428|ser
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com