TTF2 monoclonal antibody (M06), clone 1E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in human placenta.
Western Blot (Cell lysate)
TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Y-79 ( Cat # L042V1 ).
Western Blot (Cell lysate)
TTF2 monoclonal antibody (M06), clone 1E8 Western Blot analysis of TTF2 expression in NIH/3T3 ( Cat # L018V1 ).
Immunofluorescence
Immunofluorescence of monoclonal antibody to TTF2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TTF2.
Immunogen
TTF2 (NP_003585, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in human placenta.Western Blot (Cell lysate)
TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Y-79 ( Cat # L042V1 ).Western Blot (Cell lysate)
TTF2 monoclonal antibody (M06), clone 1E8 Western Blot analysis of TTF2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TTF2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TTF2
Entrez GeneID
8458GeneBank Accession#
NM_003594Protein Accession#
NP_003585Gene Name
TTF2
Gene Alias
HuF2
Gene Description
transcription termination factor, RNA polymerase II
Omim ID
604718Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing. [provided by RefSeq
Other Designations
OTTHUMP00000013818|human factor 2|lodestar protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com