DUSP11 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DUSP11 protein.
Immunogen
DUSP11 (NP_003575.1, 1 a.a. ~ 330 a.a) full-length human protein.
Sequence
MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRKNWNSSVPRSSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEWTQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (69); Rat (68)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DUSP11 MaxPab polyclonal antibody. Western Blot analysis of DUSP11 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of DUSP11 expression in transfected 293T cell line (H00008446-T01) by DUSP11 MaxPab polyclonal antibody.
Lane 1: DUSP11 transfected lysate(36.3 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DUSP11
Entrez GeneID
8446GeneBank Accession#
NM_003584.1Protein Accession#
NP_003575.1Gene Name
DUSP11
Gene Alias
PIR1
Gene Description
dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
Omim ID
603092Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is localized to the nucleus and binds directly to RNA and splicing factors, and thus it is suggested to participate in nuclear mRNA metabolism. [provided by RefSeq
Other Designations
RNA/RNP complex-interacting phosphatase|dual specificity phosphatase 11|serine/threonine specific protein phosphatase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com