Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DYRK3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008444-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DYRK3 partial ORF ( NP_003573.2, 101 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008444-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8444
  • Gene Name:
  • DYRK3
  • Gene Alias:
  • DYRK5,RED,REDK,hYAK3-2
  • Gene Description:
  • dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
  • Gene Summary:
  • This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000034527,OTTHUMP00000034528,OTTHUMP00000034529,dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 5,protein kinase Dyrk3,regulatory erythroid kinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook