BCAR3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BCAR3 partial ORF ( AAH39895, 266 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.51
Interspecies Antigen Sequence
Mouse (82); Rat (82)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BCAR3
Entrez GeneID
8412GeneBank Accession#
BC039895Protein Accession#
AAH39895Gene Name
BCAR3
Gene Alias
KIAA0554, NSP2, SH2D3B
Gene Description
breast cancer anti-estrogen resistance 3
Omim ID
604704Gene Ontology
HyperlinkGene Summary
Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. [provided by RefSeq
Other Designations
OTTHUMP00000011959|OTTHUMP00000011960|OTTHUMP00000011961|breast cancer antiestrogen resistance 3|dJ1033H22.2 (breast cancer anti-estrogen resistance 3)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com