BCAR3 monoclonal antibody (M01), clone 3G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BCAR3.
Immunogen
BCAR3 (AAH39895, 266 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCAR3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — BCAR3
Entrez GeneID
8412GeneBank Accession#
BC039895Protein Accession#
AAH39895Gene Name
BCAR3
Gene Alias
KIAA0554, NSP2, SH2D3B
Gene Description
breast cancer anti-estrogen resistance 3
Omim ID
604704Gene Ontology
HyperlinkGene Summary
Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. [provided by RefSeq
Other Designations
OTTHUMP00000011959|OTTHUMP00000011960|OTTHUMP00000011961|breast cancer antiestrogen resistance 3|dJ1033H22.2 (breast cancer anti-estrogen resistance 3)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com