Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BCAR3 polyclonal antibody (A01)

  • Catalog # : H00008412-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BCAR3.
  • Immunogen:
  • BCAR3 (AAH39895, 266 a.a. ~ 373 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008412-A01
    Western Blot detection against Immunogen (37.88 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BCAR3 expression in transfected 293T cell line by BCAR3 polyclonal antibody (A01).

    Lane1:BCAR3 transfected lysate(93 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8412
  • Gene Name:
  • BCAR3
  • Gene Alias:
  • KIAA0554,NSP2,SH2D3B
  • Gene Description:
  • breast cancer anti-estrogen resistance 3
  • Gene Summary:
  • Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011959,OTTHUMP00000011960,OTTHUMP00000011961,breast cancer antiestrogen resistance 3,dJ1033H22.2 (breast cancer anti-estrogen resistance 3)
  • RSS
  • YouTube
  • Linkedin
  • Facebook