UXT purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
UXT MaxPab polyclonal antibody. Western Blot analysis of UXT expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of UXT expression in transfected 293T cell line (H00008409-T02) by UXT MaxPab polyclonal antibody.
Lane 1: UXT transfected lysate(18.59 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to UXT on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UXT protein.
Immunogen
UXT (NP_705582.1, 1 a.a. ~ 169 a.a) full-length human protein.
Sequence
MVFPLPTPQEPIMATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UXT MaxPab polyclonal antibody. Western Blot analysis of UXT expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of UXT expression in transfected 293T cell line (H00008409-T02) by UXT MaxPab polyclonal antibody.
Lane 1: UXT transfected lysate(18.59 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to UXT on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UXT
Entrez GeneID
8409GeneBank Accession#
NM_153477Protein Accession#
NP_705582.1Gene Name
UXT
Gene Alias
ART-27
Gene Description
ubiquitously-expressed transcript
Omim ID
300234Gene Ontology
HyperlinkGene Summary
This gene encodes a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues. This gene is part of a gene cluster on chromosome Xp11.23. Alternative splicing results in 2 transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000023226|OTTHUMP00000023227
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com