Product Browser

Last updated: 2017/12/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLA2G6 polyclonal antibody (A01)

  • Catalog # : H00008398-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PLA2G6.
  • Immunogen:
  • PLA2G6 (NP_003551, 124 a.a. ~ 233 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008398-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8398
  • Gene Name:
  • PLA2G6
  • Gene Alias:
  • CaI-PLA2,GVI,INAD1,IPLA2-VIA,PARK14,PLA2,PNPLA9,iPLA2
  • Gene Description:
  • phospholipase A2, group VI (cytosolic, calcium-independent)
  • Gene Summary:
  • The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only two of them have been determined to date. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028877,calcium-independent phospholipase A2,cytosolic, calcium-independent phospholipase A2,patatin-like phospholipase domain containing 9,phospholipase A2, group VI
  • RSS
  • YouTube
  • Linkedin
  • Facebook