Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIP5K2B polyclonal antibody (A01)

  • Catalog # : H00008396-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PIP5K2B.
  • Immunogen:
  • PIP5K2B (NP_003550, 73 a.a. ~ 160 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008396-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8396
  • Gene Name:
  • PIP4K2B
  • Gene Alias:
  • PI5P4KB,PIP5K2B,PIP5KIIB,PIP5KIIbeta
  • Gene Description:
  • phosphatidylinositol-5-phosphate 4-kinase, type II, beta
  • Gene Summary:
  • The protein encoded by this gene catalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family. The encoded protein sequence does not show similarity to other kinases, but the protein does exhibit kinase activity. Additionally, the encoded protein interacts with p55 TNF receptor. [provided by RefSeq
  • Other Designations:
  • 1-phosphatidylinositol-4-phosphate kinase,PTDINS(4)P-5-kinase,diphosphoinositide kinase,phosphatidylinositol-4-phosphate 5-kinase, type II, beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook