HYAL3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HYAL3 protein.
Immunogen
HYAL3 (AAH05896.1, 1 a.a. ~ 417 a.a) full-length human protein.
Sequence
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (79); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HYAL3 MaxPab rabbit polyclonal antibody. Western Blot analysis of HYAL3 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of HYAL3 expression in transfected 293T cell line (H00008372-T02) by HYAL3 MaxPab polyclonal antibody.
Lane 1: HYAL3 transfected lysate(46.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HYAL3
Entrez GeneID
8372GeneBank Accession#
BC005896.1Protein Accession#
AAH05896.1Gene Name
HYAL3
Gene Alias
LUCA-3, LUCA14, LUCA3, Minna14
Gene Description
hyaluronoglucosaminidase 3
Omim ID
604038Gene Ontology
HyperlinkGene Summary
This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. [provided by RefSeq
Other Designations
hyaluronidase 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com