Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HIST2H4A (Human) Recombinant Protein (P01)

  • Catalog # : H00008370-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HIST2H4A full-length ORF ( AAI53064.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.28
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008370-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8370
  • Gene Name:
  • HIST2H4A
  • Gene Alias:
  • FO108,H4,H4/n,H4F2,H4FN,HIST2H4
  • Gene Description:
  • histone cluster 2, H4a
  • Gene Summary:
  • Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy. [provided by RefSeq
  • Other Designations:
  • H4 histone family, member N,H4 histone, family 2,OTTHUMP00000013906,OTTHUMP00000194862,OTTHUMP00000194863,histone 2, H4a,histone IV, family 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook