HIST1H2AC monoclonal antibody (M01), clone 4F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIST1H2AC is 0.1 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HIST1H2AC.
Immunogen
HIST1H2AC (NP_003503, 25 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIST1H2AC is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — HIST1H2AC
Entrez GeneID
8334GeneBank Accession#
NM_003512Protein Accession#
NP_003503Gene Name
HIST1H2AC
Gene Alias
H2A/l, H2AFL, MGC99519, dJ221C16.4
Gene Description
histone cluster 1, H2ac
Omim ID
602794Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq
Other Designations
H2A histone family, member L|OTTHUMP00000016145|histone 1, H2ac|histone H2AC
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com