Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC7 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008317-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDC7 partial ORF ( NP_003494, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008317-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8317
  • Gene Name:
  • CDC7
  • Gene Alias:
  • CDC7L1,HsCDC7,Hsk1,MGC117361,MGC126237,MGC126238,huCDC7
  • Gene Description:
  • cell division cycle 7 homolog (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a cell division cycle protein with kinase activity that is critical for the G1/S transition. The yeast homolog is also essential for initiation of DNA replication as cell division occurs. Overexpression of this gene product may be associated with neoplastic transformation for some tumors. Multiple alternatively spliced transcript variants that encode the same protein have been detected. [provided by RefSeq
  • Other Designations:
  • CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1,OTTHUMP00000011788,cell division cycle 7,cell division cycle 7-like protein 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook