AXIN2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AXIN2 partial ORF ( NP_004646, 745 a.a. - 843 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (98); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AXIN2
Entrez GeneID
8313GeneBank Accession#
NM_004655Protein Accession#
NP_004646Gene Name
AXIN2
Gene Alias
AXIL, DKFZp781B0869, MGC10366, MGC126582
Gene Description
axin 2
Gene Ontology
HyperlinkGene Summary
The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex of APC (adenomatous polyposis of the colon), beta-catenin, glycogen synthase kinase 3-beta, and conductin, which leads to the degradation of beta-catenin. Apparently, the deregulation of beta-catenin is an important event in the genesis of a number of malignancies. The AXIN2 gene has been mapped to 17q23-q24, a region that shows frequent loss of heterozygosity in breast cancer, neuroblastoma, and other tumors. Mutations in this gene have been associated with colorectal cancer with defective mismatch repair. [provided by RefSeq
Other Designations
conductin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Comparison of commercial nanoliquid chromatography columns for fast, targeted mass spectrometry-based proteomics.
Vehus T, Seterdal KE, Krauss S, Lundanes E, Wilson SR.
Future Science OA 2016 Mar; 2(2):FSO119.
Application:MS/MS, Recombinant protein.
-
Comparison of commercial nanoliquid chromatography columns for fast, targeted mass spectrometry-based proteomics.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com