Product Browser

Last updated: 2017/6/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACOX2 polyclonal antibody (A01)

  • Catalog # : H00008309-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ACOX2.
  • Immunogen:
  • ACOX2 (NP_003491, 582 a.a. ~ 681 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008309-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8309
  • Gene Name:
  • ACOX2
  • Gene Alias:
  • BCOX,BRCACOX,BRCOX,THCCox
  • Gene Description:
  • acyl-Coenzyme A oxidase 2, branched chain
  • Gene Summary:
  • The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe mental retardation, and death in children. [provided by RefSeq
  • Other Designations:
  • Peroxisomal branched chain acyl-CoA oxidase,THCA-CoA oxidase,Trihydroxycoprostanoyl-CoA oxidase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook