Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

USP9Y monoclonal antibody (M05), clone 2D3

  • Catalog # : H00008287-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant USP9Y.
  • Immunogen:
  • USP9Y (NP_004645, 3 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • AITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQHEDEEPAFPHTELANLDDMINRPRWVVPVL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008287-M05
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged USP9Y is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8287
  • Gene Name:
  • USP9Y
  • Gene Alias:
  • AZF,AZF1,AZFA,DFFRY,FLJ33043,SP3
  • Gene Description:
  • ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila)
  • Gene Summary:
  • This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. [provided by RefSeq
  • Other Designations:
  • azoospermia factor 1,deubiquitinating enzyme FAF-Y,fat facets protein related, Y-linked,ubiquitin specific protease 9, Y chromosome (fat facets-like Drosophila),ubiquitin specific protease 9, Y-linked,ubiquitin thiolesterase FAF-Y,ubiquitin-specific proce
  • RSS
  • YouTube
  • Linkedin
  • Facebook