Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

JARID1D (Human) Recombinant Protein (Q01)

  • Catalog # : H00008284-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human JARID1D partial ORF (NP_004644.2, 127 a.a. - 230 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • AICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGANHVQCNTHPFDNEVKDKEYKPHSIPLRQSVQPSKFSSYSRRAKRLQPDPEPTEEDIEKH
  • Theoretical MW (kDa):
  • 37.07
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00008284-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8284
  • Gene Name:
  • JARID1D
  • Gene Alias:
  • HY,HYA,KDM5D,KIAA0234,SMCY
  • Gene Description:
  • jumonji, AT rich interactive domain 1D
  • Gene Summary:
  • This gene encodes a protein containing zinc finger domains. A short peptide derived from this protein is a minor histocompatibility antigen which can lead to graft rejection of male donor cells in a female recipient. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • Jumonji, AT rich interactive domain 1D (RBP2-like),SMC homolog, Y chromosome,Smcy homolog, Y chromosome,Smcy homolog, Y-linked,histocompatibility Y antigen,selected mouse cDNA on Y, human homolog of
  • RSS
  • YouTube
  • Linkedin
  • Facebook