Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAGE3 (Human) Recombinant Protein (P01)

  • Catalog # : H00008270-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LAGE3 full-length ORF (AAH15744.2, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.13
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8270
  • Gene Name:
  • LAGE3
  • Gene Alias:
  • CVG5,DXS9879E,DXS9951E,ESO3,ITBA2
  • Gene Description:
  • L antigen family, member 3
  • Gene Summary:
  • This gene belongs to the ESO/LAGE gene family, members of which are clustered together on chromosome Xq28, and have similar exon-intron structures. Unlike the other family members which are normally expressed only in testis and activated in a wide range of human tumors, this gene is ubiquitously expressed in somatic tissues. The latter, combined with the finding that it is highly conserved in mouse and rat, suggests that the encoded protein is functionally important. An intronless pseudogene with high sequence similarity to this gene is located on chromosome 9. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032119,OTTHUMP00000061461
  • RSS
  • YouTube
  • Linkedin
  • Facebook