ARD1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ARD1 full-length ORF ( AAH00308, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
51.59
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ARD1A
Entrez GeneID
8260GeneBank Accession#
BC000308Protein Accession#
AAH00308Gene Name
ARD1A
Gene Alias
ARD1, DXS707, MGC71248, TE2
Gene Description
ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
Omim ID
300013Gene Ontology
HyperlinkGene Summary
N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. ARD1A, together with NATH (NARG1; MIM 608000), is part of a major N-alpha-acetyltransferase complex responsible for alpha-acetylation of proteins and peptides (Sanchez-Puig and Fersht, 2006 [PubMed 16823041]).[supplied by OMIM
Other Designations
ARD1 homolog, N-acetyltransferase|N-acetyltransferase ARD1|N-acetyltransferase ARD1, human homolog of|OTTHUMP00000026001
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
ARD1 stabilizes NRF2 through direct interaction and promotes colon cancer progression.
Xizhu Fang, Yeon-Hwa Lee, Jeong-Hoon Jang, Su-Jung Kim, Seong Hoon Kim, Do-Hee Kim, Hye-Kyung Na, Kyung-Ok Kim, Jeong-Heum Baek, Young-Joon Surh.
Life Sciences 2023 Jan; 313:121217.
Application：Mass Spectrometric, Recombinant proteins.
-
ARD1 stabilizes NRF2 through direct interaction and promotes colon cancer progression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com