Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARD1 (Human) Recombinant Protein (P01)

  • Catalog # : H00008260-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARD1 full-length ORF ( AAH00308, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.59
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008260-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8260
  • Gene Name:
  • ARD1A
  • Gene Alias:
  • ARD1,DXS707,MGC71248,TE2
  • Gene Description:
  • ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
  • Gene Summary:
  • N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. ARD1A, together with NATH (NARG1; MIM 608000), is part of a major N-alpha-acetyltransferase complex responsible for alpha-acetylation of proteins and peptides (Sanchez-Puig and Fersht, 2006 [PubMed 16823041]).[supplied by OMIM
  • Other Designations:
  • ARD1 homolog, N-acetyltransferase,N-acetyltransferase ARD1,N-acetyltransferase ARD1, human homolog of,OTTHUMP00000026001
  • RSS
  • YouTube
  • Linkedin
  • Facebook