ARD1A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ARD1A MaxPab polyclonal antibody. Western Blot analysis of ARD1A expression in human pancreas.
Western Blot (Cell lysate)
ARD1A MaxPab polyclonal antibody. Western Blot analysis of ARD1A expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of ARD1A expression in transfected 293T cell line (H00008260-T01) by ARD1A MaxPab polyclonal antibody.
Lane 1: ARD1A transfected lysate(25.85 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ARD1A protein.
Immunogen
ARD1A (NP_003482.1, 1 a.a. ~ 235 a.a) full-length human protein.
Sequence
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ARD1A MaxPab polyclonal antibody. Western Blot analysis of ARD1A expression in human pancreas.Western Blot (Cell lysate)
ARD1A MaxPab polyclonal antibody. Western Blot analysis of ARD1A expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of ARD1A expression in transfected 293T cell line (H00008260-T01) by ARD1A MaxPab polyclonal antibody.
Lane 1: ARD1A transfected lysate(25.85 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ARD1A
Entrez GeneID
8260GeneBank Accession#
NM_003491.2Protein Accession#
NP_003482.1Gene Name
ARD1A
Gene Alias
ARD1, DXS707, MGC71248, TE2
Gene Description
ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
Omim ID
300013Gene Ontology
HyperlinkGene Summary
N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. ARD1A, together with NATH (NARG1; MIM 608000), is part of a major N-alpha-acetyltransferase complex responsible for alpha-acetylation of proteins and peptides (Sanchez-Puig and Fersht, 2006 [PubMed 16823041]).[supplied by OMIM
Other Designations
ARD1 homolog, N-acetyltransferase|N-acetyltransferase ARD1|N-acetyltransferase ARD1, human homolog of|OTTHUMP00000026001
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com