RBM10 monoclonal antibody (M03), clone 2F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RBM10 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RBM10.
Immunogen
RBM10 (NP_690595.1, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RBM10 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — RBM10
Entrez GeneID
8241GeneBank Accession#
NM_152856Protein Accession#
NP_690595.1Gene Name
RBM10
Gene Alias
DXS8237E, GPATC9, GPATCH9, KIAA0122, MGC1132, MGC997, ZRANB5
Gene Description
RNA binding motif protein 10
Omim ID
300080Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023192|RNA-binding protein S1-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com