USP9X monoclonal antibody (M01), clone 1C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant USP9X.
Immunogen
USP9X (NP_068706, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP9X is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP9X on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — USP9X
Entrez GeneID
8239GeneBank Accession#
NM_021906Protein Accession#
NP_068706Gene Name
USP9X
Gene Alias
DFFRX, FAF, FAM
Gene Description
ubiquitin specific peptidase 9, X-linked
Omim ID
300072Gene Ontology
HyperlinkGene Summary
This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
Drosophila fat facets related, X-linked|deubiquitinating enzyme FAF-X|fat facets protein related, X-linked|ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila)|ubiquitin specific protease 9, X chromosome (fat facets-like Drosophila)|ubiq
-
Interactome
-
Disease
-
Publication Reference
-
USP9X mediates an acute adaptive response to MAPK suppression in pancreatic cancer but creates multiple actionable therapeutic vulnerabilities.
Naiara Perurena, Rebecca Lock, Rachel A Davis, Srivatsan Raghavan, Natalie F Pilla, Raymond Ng, Patrick Loi, Caroline J Guild, Abigail L Miller, Ewa Sicinska, James M Cleary, Douglas A Rubinson, Brian M Wolpin, Nathanael S Gray, Sandro Santagata, William C Hahn, Jennifer P Morton, Owen J Sansom, Andrew J Aguirre, Karen Cichowski.
Cell Reports. Medicine 2023 Apr; 4(4):101007.
Application:WB-Tr, Human, PANC 10.05 cells.
-
AMOTL2 mono-ubiquitination by WWP1 promotes contact inhibition by facilitating LATS activation.
Daehee Hwang, Miju Kim, Soyeon Kim, Mi Ra Kwon, Ye-Seul Kang, Dahyun Kim, Ho-Chul Kang, Dae-Sik Lim.
Life Science Alliance 2021 Aug; 4(10):e202000953.
Application:WB-Tr, Human, HEK 293T cells.
-
Upregulation of DR5 and Downregulation of Survivin by IITZ-01, Lysosomotropic Autophagy Inhibitor, Potentiates TRAIL-Mediated Apoptosis in Renal Cancer Cells via Ubiquitin-Proteasome Pathway.
Sk Abrar Shahriyar, Seung Un Seo, Kyoung-Jin Min, Peter Kubatka, Do Sik Min, Jong-Soo Chang, Dong Eun Kim, Seon Min Woo, Taeg Kyu Kwon.
Cancers 2020 Aug; 12(9):E2363.
Application:WB, Human, A498, A549, Caki-1, MCF7 cells.
-
The Histone Lysine-specific Demethylase 1 Inhibitor, SP2509 Exerts Cytotoxic Effects against Renal Cancer Cells through Downregulation of Bcl-2 and Mcl-1.
Kaixin Wu, Seon Min Woo, Taeg Kyu Kwon.
Journal of Cancer Prevention 2020 Jun; 25(2):79.
Application:WB, Human, Caki cells.
-
Honokiol Enhances TRAIL-Mediated Apoptosis through STAMBPL1-Induced Survivin and c-FLIP Degradation.
Woo SM, Seo SU, Kubatka P, Min KJ, Kwon TK.
Biomolecules 2019 Dec; 9(12):E838.
Application:WB-Ce, Human, Caki cells.
-
Deubiquitylating enzyme USP9x regulates radiosensitivity in glioblastoma cells by Mcl-1-dependent and -independent mechanisms.
Wolfsperger F, Hogh-Binder SA, Schittenhelm J, Psaras T, Ritter V, Bornes L, Huber SM, Jendrossek V, Rudner J.
Cell Death & Disease 2016 Jan; 7:e2039.
Application:IP, IHC, Human, Astrocytoma and Glioblastoma Tissue Samples, A172 Ccells, U373 cells.
-
Role of Angiomotin-like 2 mono-ubiquitination on YAP inhibition.
Kim M, Kim M, Park SJ, Lee C, Lim DS.
EMBO Reports 2016 Jan; 17(1):64.
Application:WB-Tr, Human, 293T, RPE, MCF10A cells.
-
Role of Ku70 in deubiquitination of Mcl-1 and suppression of apoptosis.
Wang B, Xie M, Li R, Owonikoko TK, Ramalingam SS, Khuri FR, Curran WJ, Wang Y, Deng X.
Cell Death and Differentiation 2014 Jul; 21(7):1160.
Application:WB-Ce, WB-Tr, Human, H1299, HEK29, HCT116 cells.
-
Deubiquitinase USP9x confers radioresistance through stabilization of Mcl-1.
Trivigno D, Essmann F, Huber SM, Rudner J.
Neoplasia 2012 Oct; 14(10):893.
Application:WB-Ce, WB-Tr, Human, Jurkat, K-562 cells.
-
Mcl-1 Phosphorylation defines ABT-737 resistance that can be overcome by increased NOXA expression in leukemic B cells.
Mazumder S, Choudhary GS, Al-Harbi S, Almasan A.
Cancer Research 2012 Jun; 72(12):3069.
Application:WB-Ce, Human, ABT-R Nalm-6 cells.
-
The Bcl-xL inhibitor, ABT-737, efficiently induces apoptosis and suppresses growth of hepatoma cells in combination with sorafenib.
Hikita H, Takehara T, Shimizu S, Kodama T, Shigekawa M, Iwase K, Hosui A, Miyagi T, Tatsumi T, Ishida H, Li W, Kanto T, Hiramatsu N, Hayashi N.
Hepatology 2010 Oct; 52(4):1310.
Application:WB-Tr, Human, Hep3B, Huh7.
-
USP9X mediates an acute adaptive response to MAPK suppression in pancreatic cancer but creates multiple actionable therapeutic vulnerabilities.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com