Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

USP11 polyclonal antibody (A01)

  • Catalog # : H00008237-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant USP11.
  • Immunogen:
  • USP11 (NP_004642, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008237-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8237
  • Gene Name:
  • USP11
  • Gene Alias:
  • UHX1
  • Gene Description:
  • ubiquitin specific peptidase 11
  • Gene Summary:
  • Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. This gene encodes a deubiquitinating enzyme which lies in a gene cluster on chromosome Xp11.23 [provided by RefSeq
  • Other Designations:
  • deubiquitinating enzyme 11,ubiquitin carboxyl-terminal hydrolase, X-linked,ubiquitin specific protease 11,ubiquitin thiolesterase 11,ubiquitin-specific processing protease 11
  • RSS
  • YouTube
  • Linkedin
  • Facebook