ZRSR2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ZRSR2 full-length ORF ( NP_005080.1, 1 a.a. - 482 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
84.4
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ZRSR2
Entrez GeneID
8233GeneBank Accession#
NM_005089.2Protein Accession#
NP_005080.1Gene Name
ZRSR2
Gene Alias
MGC142014, MGC142040, U2AF1-RS2, U2AF1L2, U2AF1RS2, URP
Gene Description
zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
Omim ID
300028Gene Ontology
HyperlinkGene Summary
This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly. [provided by RefSeq
Other Designations
OTTHUMP00000022976|U2 small nuclear RNA auxiliary factor 1-like 2|U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2|U2(RNU2) small nuclear RNA auxiliary factor 1-like 2|U2AF35-related protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com