Product Browser

Last updated: 2022/7/3

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

U2AF1L2 purified MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00008233-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human U2AF1L2 protein.
  • Immunogen:
  • U2AF1L2 (NP_005080, 1 a.a. ~ 482 a.a) full-length human protein.
  • Sequence:
  • MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (82); Rat (83)
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • U2AF1L2 MaxPab polyclonal antibody. Western Blot analysis of U2AF1L2 expression in human placenta.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ZRSR2 expression in transfected 293T cell line (H00008233-T01) by ZRSR2 MaxPab polyclonal antibody.

    Lane 1: U2AF1L2 transfected lysate(53.02 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8233
  • Gene Name:
  • ZRSR2
  • Gene Alias:
  • MGC142014,MGC142040,U2AF1-RS2,U2AF1L2,U2AF1RS2,URP
  • Gene Description:
  • zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
  • Gene Summary:
  • This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022976,U2 small nuclear RNA auxiliary factor 1-like 2,U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2,U2(RNU2) small nuclear RNA auxiliary factor 1-like 2,U2AF35-related protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook