U2AF1L2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human U2AF1L2 protein.
Immunogen
U2AF1L2 (NP_005080, 1 a.a. ~ 482 a.a) full-length human protein.
Sequence
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
U2AF1L2 MaxPab polyclonal antibody. Western Blot analysis of U2AF1L2 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of ZRSR2 expression in transfected 293T cell line (H00008233-T01) by ZRSR2 MaxPab polyclonal antibody.
Lane 1: U2AF1L2 transfected lysate(53.02 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ZRSR2
Entrez GeneID
8233GeneBank Accession#
NM_005089Protein Accession#
NP_005080Gene Name
ZRSR2
Gene Alias
MGC142014, MGC142040, U2AF1-RS2, U2AF1L2, U2AF1RS2, URP
Gene Description
zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
Omim ID
300028Gene Ontology
HyperlinkGene Summary
This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly. [provided by RefSeq
Other Designations
OTTHUMP00000022976|U2 small nuclear RNA auxiliary factor 1-like 2|U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2|U2(RNU2) small nuclear RNA auxiliary factor 1-like 2|U2AF35-related protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com