Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DGCR14 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008220-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DGCR14 partial ORF ( NP_073210, 377 a.a. - 476 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNLLQLPARRKASDFF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008220-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8220
  • Gene Name:
  • DGCR14
  • Gene Alias:
  • DGCR13,DGS-H,DGS-I,DGSH,DGSI,ES2,Es2el
  • Gene Description:
  • DiGeorge syndrome critical region gene 14
  • Gene Summary:
  • This gene is located within the minimal DGS critical region (MDGCR) thought to contain the gene(s) responsible for a group of developmental disorders. These disorders include DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome, and some familial or sporadic conotruncal cardiac defects which have been associated with microdeletion of 22q11.2. The encoded protein may be a component of C complex spliceosomes, and the orthologous protein in the mouse localizes to the nucleus. [provided by RefSeq
  • Other Designations:
  • DiGeorge syndrome critical region gene 13,DiGeorge syndrome critical region gene DGSI,DiGeorge syndrome critical region protein 14,DiGeorge syndrome gene H,DiGeorge syndrome gene I,Protein DGCR13
  • RSS
  • YouTube
  • Linkedin
  • Facebook