Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DGCR14 polyclonal antibody (A01)

  • Catalog # : H00008220-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DGCR14.
  • Immunogen:
  • DGCR14 (NP_073210, 377 a.a. ~ 476 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNLLQLPARRKASDFF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008220-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DGCR14 polyclonal antibody (A01), Lot # 051108JC01 Western Blot analysis of DGCR14 expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8220
  • Gene Name:
  • DGCR14
  • Gene Alias:
  • DGCR13,DGS-H,DGS-I,DGSH,DGSI,ES2,Es2el
  • Gene Description:
  • DiGeorge syndrome critical region gene 14
  • Gene Summary:
  • This gene is located within the minimal DGS critical region (MDGCR) thought to contain the gene(s) responsible for a group of developmental disorders. These disorders include DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome, and some familial or sporadic conotruncal cardiac defects which have been associated with microdeletion of 22q11.2. The encoded protein may be a component of C complex spliceosomes, and the orthologous protein in the mouse localizes to the nucleus. [provided by RefSeq
  • Other Designations:
  • DiGeorge syndrome critical region gene 13,DiGeorge syndrome critical region gene DGSI,DiGeorge syndrome critical region protein 14,DiGeorge syndrome gene H,DiGeorge syndrome gene I,Protein DGCR13
  • RSS
  • YouTube
  • Linkedin
  • Facebook