DGCR6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DGCR6 expression in transfected 293T cell line (H00008214-T01) by DGCR6 MaxPab polyclonal antibody.
Lane 1: DGCR6 transfected lysate(24.2 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to DGCR6 on HepG2 cell. [antibody concentration 20 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DGCR6 protein.
Immunogen
DGCR6 (NP_005666.2, 1 a.a. ~ 220 a.a) full-length human protein.
Sequence
MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQCDQKGSPVPP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DGCR6 expression in transfected 293T cell line (H00008214-T01) by DGCR6 MaxPab polyclonal antibody.
Lane 1: DGCR6 transfected lysate(24.2 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to DGCR6 on HepG2 cell. [antibody concentration 20 ug/ml] -
Gene Info — DGCR6
Entrez GeneID
8214GeneBank Accession#
NM_005675.3Protein Accession#
NP_005666.2Gene Name
DGCR6
Gene Alias
-
Gene Description
DiGeorge syndrome critical region gene 6
Omim ID
601279Gene Ontology
HyperlinkGene Summary
DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq
Other Designations
DiGeorge syndrome critical region protein 6
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com