C21orf33 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
C21orf33 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of C21orf33 expression in K-562 ( Cat # L009V1 ).
Western Blot (Cell lysate)
C21orf33 polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of C21orf33 expression in Raw 264.7.
Western Blot detection against Immunogen (35.02 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant C21orf33.
Immunogen
C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
Sequence
RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (93); Rat (91)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.02 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
C21orf33 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of C21orf33 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
C21orf33 polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of C21orf33 expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — C21orf33
Entrez GeneID
8209GeneBank Accession#
NM_004649Protein Accession#
NP_004640Gene Name
C21orf33
Gene Alias
D21S2048E, ES1, GT335, HES1, KNP-I, KNPH, KNPI
Gene Description
chromosome 21 open reading frame 33
Omim ID
601659Gene Ontology
HyperlinkGene Summary
homolog to E.coli and zebrafish ES1 protein
Other Designations
Keio novel protein I|es1 protein|human HES1 protein, homolog to E.coli and zebrafish ES1 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com