Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NRIP1 polyclonal antibody (A01)

  • Catalog # : H00008204-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NRIP1.
  • Immunogen:
  • NRIP1 (NP_003480, 1051 a.a. ~ 1158 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSANGEVYGLLGSVLTIKKESE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008204-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8204
  • Gene Name:
  • NRIP1
  • Gene Alias:
  • FLJ77253,RIP140
  • Gene Description:
  • nuclear receptor interacting protein 1
  • Gene Summary:
  • Nuclear receptor interacting protein 1 (NRIP1) is a nuclear protein that specifically interacts with the hormone-dependent activation domain AF2 of nuclear receptors. Also known as RIP140, this protein modulates transcriptional activity of the estrogen receptor. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000083036,OTTHUMP00000083037,nuclear factor RIP140,receptor interacting protein 140
  • RSS
  • YouTube
  • Linkedin
  • Facebook