Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NCOA3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008202-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NCOA3 partial ORF ( NP_006525, 251 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008202-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8202
  • Gene Name:
  • NCOA3
  • Gene Alias:
  • ACTR,AIB-1,AIB1,CAGH16,CTG26,KAT13B,MGC141848,RAC3,SRC3,TNRC14,TNRC16,TRAM-1,bHLHe42,pCIP
  • Gene Description:
  • nuclear receptor coactivator 3
  • Gene Summary:
  • The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein. [provided by RefSeq
  • Other Designations:
  • CBP-interacting protein,OTTHUMP00000031716,OTTHUMP00000031718,amplified in breast cancer-1,receptor-associated coactivator 3,steroid receptor coactivator protein 3,thyroid hormone receptor activator molecule 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook