NCOA3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NCOA3 partial ORF ( NP_006525, 251 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (91)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NCOA3
Entrez GeneID
8202GeneBank Accession#
NM_006534Protein Accession#
NP_006525Gene Name
NCOA3
Gene Alias
ACTR, AIB-1, AIB1, CAGH16, CTG26, KAT13B, MGC141848, RAC3, SRC3, TNRC14, TNRC16, TRAM-1, bHLHe42, pCIP
Gene Description
nuclear receptor coactivator 3
Omim ID
601937Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein. [provided by RefSeq
Other Designations
CBP-interacting protein|OTTHUMP00000031716|OTTHUMP00000031718|amplified in breast cancer-1|receptor-associated coactivator 3|steroid receptor coactivator protein 3|thyroid hormone receptor activator molecule 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com