Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NCOA3 polyclonal antibody (A01)

  • Catalog # : H00008202-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NCOA3.
  • Immunogen:
  • NCOA3 (NP_006525, 251 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008202-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8202
  • Gene Name:
  • NCOA3
  • Gene Alias:
  • ACTR,AIB-1,AIB1,CAGH16,CTG26,KAT13B,MGC141848,RAC3,SRC3,TNRC14,TNRC16,TRAM-1,bHLHe42,pCIP
  • Gene Description:
  • nuclear receptor coactivator 3
  • Gene Summary:
  • The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein. [provided by RefSeq
  • Other Designations:
  • CBP-interacting protein,OTTHUMP00000031716,OTTHUMP00000031718,amplified in breast cancer-1,receptor-associated coactivator 3,steroid receptor coactivator protein 3,thyroid hormone receptor activator molecule 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook