Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLPP (Human) Recombinant Protein (P01)

  • Catalog # : H00008192-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLPP full-length ORF ( NP_006003.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 56.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008192-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8192
  • Gene Name:
  • CLPP
  • Gene Alias:
  • -
  • Gene Description:
  • ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
  • Gene Summary:
  • The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq
  • Other Designations:
  • ATP-dependent protease ClpAP, proteolytic subunit, human,ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog,endopeptidase Clp
  • RSS
  • YouTube
  • Linkedin
  • Facebook