CLPP monoclonal antibody (M01), clone 3E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CLPP monoclonal antibody (M01), clone 3E2 Western Blot analysis of CLPP expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
CLPP monoclonal antibody (M01), clone 3E2. Western Blot analysis of CLPP expression in PC-12 ( Cat # L012V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLPP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLPP is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CLPP.
Immunogen
CLPP (NP_006003, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (98)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CLPP monoclonal antibody (M01), clone 3E2 Western Blot analysis of CLPP expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
CLPP monoclonal antibody (M01), clone 3E2. Western Blot analysis of CLPP expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLPP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLPP is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — CLPP
Entrez GeneID
8192GeneBank Accession#
NM_006012Protein Accession#
NP_006003Gene Name
CLPP
Gene Alias
-
Gene Description
ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
Omim ID
601119Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq
Other Designations
ATP-dependent protease ClpAP, proteolytic subunit, human|ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog|endopeptidase Clp
-
Interactome
-
Publication Reference
-
Diphenylarsinic acid promotes degradation of glutaminase C by mitochondrial Lon protease.
Kita K, Suzuki T, Ochi T.
The Journal of Biological Chemistry 2012 May; 287(22):18163.
Application：WB-Tr, Human, HepG2 cells.
-
Diphenylarsinic acid promotes degradation of glutaminase C by mitochondrial Lon protease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com