Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLPP polyclonal antibody (A01)

  • Catalog # : H00008192-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CLPP.
  • Immunogen:
  • CLPP (NP_006003, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008192-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8192
  • Gene Name:
  • CLPP
  • Gene Alias:
  • -
  • Gene Description:
  • ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
  • Gene Summary:
  • The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq
  • Other Designations:
  • ATP-dependent protease ClpAP, proteolytic subunit, human,ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog,endopeptidase Clp
  • RSS
  • YouTube
  • Linkedin
  • Facebook