Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SF3A2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008175-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SF3A2 partial ORF ( NP_009096, 112 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.29
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008175-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8175
  • Gene Name:
  • SF3A2
  • Gene Alias:
  • PRP11,PRPF11,SAP62,SF3a66
  • Gene Description:
  • splicing factor 3a, subunit 2, 66kDa
  • Gene Summary:
  • This gene encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein. [provided by RefSeq
  • Other Designations:
  • pre-mRNA splicing factor SF3A, subunit 2,spliceosome associated protein 62,splicing factor 3a, subunit 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook