SF3A2 monoclonal antibody (M01), clone 3B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunofluorescence
Immunofluorescence of monoclonal antibody to SF3A2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.29 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SF3A2.
Immunogen
SF3A2 (NP_009096, 112 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SF3A2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SF3A2
Entrez GeneID
8175GeneBank Accession#
NM_007165Protein Accession#
NP_009096Gene Name
SF3A2
Gene Alias
PRP11, PRPF11, SAP62, SF3a66
Gene Description
splicing factor 3a, subunit 2, 66kDa
Omim ID
600796Gene Ontology
HyperlinkGene Summary
This gene encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein. [provided by RefSeq
Other Designations
pre-mRNA splicing factor SF3A, subunit 2|spliceosome associated protein 62|splicing factor 3a, subunit 2
-
Interactome
-
Disease
-
Publication Reference
-
Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.
Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA.
Cell Cycle 2012 Jun; 11(12):2367.
Application：Array, Human, SCC cell.
-
Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com