Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKAP1 polyclonal antibody (A01)

  • Catalog # : H00008165-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AKAP1.
  • Immunogen:
  • AKAP1 (NP_003479, 806 a.a. ~ 903 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008165-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • AKAP1 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of AKAP1 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8165
  • Gene Name:
  • AKAP1
  • Gene Alias:
  • AKAP,AKAP121,AKAP149,AKAP84,D-AKAP1,MGC1807,PRKA1,SAKAP84
  • Gene Description:
  • A kinase (PRKA) anchor protein 1
  • Gene Summary:
  • The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. [provided by RefSeq
  • Other Designations:
  • A-kinase anchor protein 1,A-kinase anchor protein, 149kD,dual-specificity A-kinase anchoring protein 1,protein kinase A anchoring protein 1,protein kinase A1,spermatid A-kinase anchor protein 84
  • RSS
  • YouTube
  • Linkedin
  • Facebook