COIL purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human COIL protein.
Immunogen
COIL (NP_004636.1, 1 a.a. ~ 576 a.a) full-length human protein.
Sequence
MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of COIL expression in transfected 293T cell line (H00008161-T01) by COIL MaxPab polyclonal antibody.
Lane 1: COIL transfected lysate(63.36 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to COIL on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — COIL
Entrez GeneID
8161GeneBank Accession#
NM_004645.2Protein Accession#
NP_004636.1Gene Name
COIL
Gene Alias
CLN80, p80-coilin
Gene Description
coilin
Omim ID
600272Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies. This gene has pseudogenes on chromosome 4 and chromosome 14. [provided by RefSeq
Other Designations
coilin p80
-
Interactome
-
Disease
-
Publication Reference
-
Regulation of the oncogenic phenotype by the nuclear body protein ZC3H8.
Schmidt JA, Danielson KG, Duffner ER, Radecki SG, Walker GT, Shelton A, Wang T, Knepper JE.
BMC Cancer 2018 Jul; 18(1):759.
Application:IF, Mouse, cV1A 03–31 mouse mammary carcinoma cells.
-
Regulation of the oncogenic phenotype by the nuclear body protein ZC3H8.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com