Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RND2 (Human) Recombinant Protein (P01)

  • Catalog # : H00008153-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RND2 full-length ORF ( AAH18096, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCNLM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008153-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8153
  • Gene Name:
  • RND2
  • Gene Alias:
  • ARHN,RHO7,RhoN
  • Gene Description:
  • Rho family GTPase 2
  • Gene Summary:
  • This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neuronal morphology and endosomal trafficking. The gene localizes to chromosome 17 and is the centromeric neighbor of the breast-ovarian cancer susceptibility gene BRCA1. [provided by RefSeq
  • Other Designations:
  • GTP-binding protein Rho7,Rho-related GTP-binding protein RhoN,ras homolog gene family, member N
  • RSS
  • YouTube
  • Linkedin
  • Facebook